Protein Info for GFF5930 in Variovorax sp. SCN45

Annotation: VgrG protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 792 TIGR03361: type VI secretion system Vgr family protein" amino acids 15 to 336 (322 residues), 191.1 bits, see alignment E=3.1e-60 amino acids 392 to 566 (175 residues), 289.2 bits, see alignment E=5.6e-90 TIGR01646: Rhs element Vgr protein" amino acids 22 to 330 (309 residues), 158.2 bits, see alignment E=3.6e-50 amino acids 389 to 549 (161 residues), 207.7 bits, see alignment E=3.5e-65 PF05954: Phage_GPD" amino acids 26 to 334 (309 residues), 221.5 bits, see alignment E=2.4e-69 PF04717: Phage_base_V" amino acids 431 to 499 (69 residues), 57.1 bits, see alignment E=2.9e-19 PF06715: Gp5_C" amino acids 572 to 595 (24 residues), 22.7 bits, see alignment (E = 1.2e-08) amino acids 597 to 619 (23 residues), 21.2 bits, see alignment (E = 3.4e-08) amino acids 621 to 642 (22 residues), 21.3 bits, see alignment (E = 3.4e-08)

Best Hits

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_0573)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (792 amino acids)

>GFF5930 VgrG protein (Variovorax sp. SCN45)
MADHEFRIDSDSPVNGELMFWRIAGHEALARASSYELTVLSKSRTLDARDILGRAFDVSI
EFEDADGARHVRHCQGHAVRFMRAGHVGRYFEYRIALRSWFWLLTKRINSRILQDKKVLE
VLDAVFEDSPIKRFKKTRADNVIGTHEPRRYCVQHQESDYQFLSRLLEDEGIYYWFDAHD
APGTMHLSDASDLAHDKLPAASTLNFMPAGATEPRDNEISRWISERQFDTGKYASRDSNF
KSIKKKLEATGGEPDKCELSEFEAFEFAGGYFSGGDADDKGKLRGEEIGARRQRHFALTR
WPDVAAGRSFTFKGDPDAARDGDYVIAACTFVASHSGYEGVPEVGDPVPLDVLLREALED
DAVCADTLPVLRELVAQTPALRAGRNGDSAFLLTVMPIDVPFRPPRLTPRVRMPGPQSAI
VVGPDGEEIHADDFGRVKVHFHWDRYDKSNEKSTCWVRVSQPWAGKGWGGYFIPRIGQEV
IVDFLNGDPDRPLVIGRVYNDDQPIPFGSHTQSGFRTRSTPKGSAANCNEFRFEDKKGSE
QVYLHAEKNQDIEVENDETHWVGHDRKKTVDHDETVHVKHDRTETVGNNEKITIGVNRTE
SVGNNETISIGVNRTETVGSNETITIGSNRTITVGASETATVALQRTHTVGVNETITVGA
AQEITVGAVQAVTVGASQTISVGANQSSSIGANRSVDVGANLTTNVGSDEARSVGKGRST
SVGKDDSLSVGKNLVISAGDSISITTGSASITMKKDGTIVIKGKDITIDASGKINAKASS
DIVMKGSKILQN