Protein Info for GFF5911 in Variovorax sp. SCN45

Annotation: Probable L-amino-acid oxidase (EC 1.4.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF07992: Pyr_redox_2" amino acids 11 to 204 (194 residues), 46.9 bits, see alignment E=1.1e-15 TIGR04046: flavin-dependent oxidoreductase, MSMEG_0569 family" amino acids 11 to 414 (404 residues), 667.7 bits, see alignment E=3e-205 PF01494: FAD_binding_3" amino acids 11 to 43 (33 residues), 28.7 bits, see alignment (E = 3.8e-10) PF13738: Pyr_redox_3" amino acids 14 to 209 (196 residues), 74.2 bits, see alignment E=5.2e-24 PF13434: Lys_Orn_oxgnase" amino acids 105 to 203 (99 residues), 40.2 bits, see alignment E=1e-13 PF00743: FMO-like" amino acids 133 to 206 (74 residues), 25.4 bits, see alignment E=2.2e-09

Best Hits

KEGG orthology group: K07222, putative flavoprotein involved in K+ transport (inferred from 90% identity to vpe:Varpa_0592)

Predicted SEED Role

"monooxygenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>GFF5911 Probable L-amino-acid oxidase (EC 1.4.3.2) (Variovorax sp. SCN45)
MSHPHGGRSHYSVVIVGGGQAGLSLSHGLQQRGIDHLVIEKRSLVHTWRTQRWDSFCLVT
PNWQCQLPGWGYTGGDPHGFMVKDQINEWLAGFVDHVKAPAIEGVTVERVSRVARDGERE
RFSVQTDAGLYTADQVVVASGGYHRPVVPRLAEKLPAGVAQFHSAQYRNPAQLPEGAVLV
VGCGQSGAQIAEDLHLAGRKVHLATGNAPRCARFYRGREVVDWLADMKYYDMPVTEHPLR
EGVRDNTNHYVTGRDGGRDIDLRRFALEGMELYGLLSGFDNGSFELQPNLRDNLDQADET
YNRINASIDRHIAAKGIEAPPPSVYTPVWVPGEERTRLDLAAAGIASVVWCIGFSPDFAW
VDAPVFNGRGAPVHLRGVTNEPGLYFLGLPWLHTWGSGRFSGVARDAEFLAQAIAERKAS
RRGDEAAPAPVLRAA