Protein Info for GFF591 in Variovorax sp. SCN45

Annotation: Renalase (EC 1.6.3.5), oxidases 1,2-dihydro- and 1,6-dihydro- beta-NAD(P)H isomers back to NAD(P)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF07992: Pyr_redox_2" amino acids 27 to 72 (46 residues), 31.5 bits, see alignment 3.9e-11 PF01266: DAO" amino acids 28 to 62 (35 residues), 32.3 bits, see alignment 2.4e-11 PF00890: FAD_binding_2" amino acids 29 to 64 (36 residues), 21.9 bits, see alignment 2.7e-08 PF13450: NAD_binding_8" amino acids 30 to 83 (54 residues), 52 bits, see alignment 2.1e-17 PF01593: Amino_oxidase" amino acids 35 to 86 (52 residues), 34.7 bits, see alignment 4e-12 amino acids 125 to 365 (241 residues), 38.7 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: K06955, (no description) (inferred from 87% identity to vap:Vapar_3125)

Predicted SEED Role

"COG3380: Amine oxidase, flavin-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>GFF591 Renalase (EC 1.6.3.5), oxidases 1,2-dihydro- and 1,6-dihydro- beta-NAD(P)H isomers back to NAD(P) (Variovorax sp. SCN45)
MTSRATAKPADRHRTPATPRSSPPSRHYAVVGAGIAGVACARTLVQAGHKVTLFERETTA
GGRMASVDTAFGRFDSGAQYFTVRDPRFALALESTPGVCKRWSANLVRVLDAHGRVAEAA
LPSLESHWVAQPGMDALVAHWAKPLGDSLVTGTQVTQIEPDALDAKRWQLRTAGADDSRH
VYSGFDAVLLAVPPSRARALLDGGKLSAKLSAKVEPVRIAPCWTLMIAYPQANQPTMSHL
GPQWNAARSTHHRVAWLARESSKPGREPVERWTLQASAAWSQEHLRDTPARVEAKLLRAF
AEITGIHATPAHAQALCWSEAQTQVPVGTTHLWDTKARIGVAGDWCTGHRVEDAFLSGLS
LALAVI