Protein Info for GFF59 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tyrosine-protein kinase Wzc (EC 2.7.10.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details TIGR03017: chain length determinant protein EpsF" amino acids 1 to 442 (442 residues), 601.8 bits, see alignment E=3.5e-185 PF02706: Wzz" amino acids 5 to 88 (84 residues), 33.8 bits, see alignment E=3.4e-12 PF13807: GNVR" amino acids 343 to 416 (74 residues), 37 bits, see alignment E=2.6e-13

Best Hits

KEGG orthology group: None (inferred from 59% identity to nmu:Nmul_A0243)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>GFF59 Tyrosine-protein kinase Wzc (EC 2.7.10.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTPQQLLTVLRARWLVVFLTFMVVVAGTAALTLTAAKQYTATAAVVLDVKSPDPVSGQTL
AGLMAPGYMATQVDIIKSDRVAKRVVSALRLDSSAAVQSQWREATEGRGQITDWLSALLQ
RNLDVKPSRESNVISIEYMGADPNFAALVANAFARAYVEVNLELRVDPARSYAGFFDEQT
KAARDRLEIAQKALSDFQQINGITSTDERLDFETAKLNETSSQLTSIQAATTDSQSKRQR
SDADTVAEVMQSPLVNGLKGDIARLEARLTETGVNLGKNHPQTLRYESELATLRAQLDAE
TRQITSAITTTYQVNRQREAQLQAALNQQKDRVLELNKQRDQIAVLRRDIESAQRVFESV
SLRASQSSIESQTSQTNIAVLNPAIAPTFPSGPRVKLNIAIAMFLGGLLGVMLALALEFA
NRRVRSADDLRALRDVVLLGSIGPAGGMMKPTAGARA