Protein Info for GFF588 in Sphingobium sp. HT1-2

Annotation: Beta-carotene hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details

Best Hits

Swiss-Prot: 50% identical to CRTZ_PANAN: Beta-carotene hydroxylase (crtZ) from Pantoea ananas

KEGG orthology group: K02294, beta-carotene hydroxylase [EC: 1.14.13.-] (inferred from 79% identity to sjp:SJA_C1-06860)

MetaCyc: 50% identical to beta-carotene hydroxylase (Pantoea ananatis)
RXN-8025 [EC: 1.14.15.24]; 1.14.15.24 [EC: 1.14.15.24]

Predicted SEED Role

"Beta-carotene hydroxylase" in subsystem Carotenoids

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.15.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>GFF588 Beta-carotene hydroxylase (Sphingobium sp. HT1-2)
MPPIALLLLFVVTIALMEGFAYVMHRWVMHGPGWFLHASHHRPRTGFFEANDLYFVIFAM
PSILLLLGGVQWGWGNWATAVGAGVAAYGAIYLGFHDIIVHQRVRHRYVARSRYMKRIVQ
AHRLHHAVETKDGTVSFGFLIAPHPADLKRELARRGRAGVRAARDWQPGTRD