Protein Info for GFF588 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF00581: Rhodanese" amino acids 8 to 98 (91 residues), 65.4 bits, see alignment E=2.8e-22

Best Hits

Swiss-Prot: 100% identical to GLPE_SALEP: Thiosulfate sulfurtransferase GlpE (glpE) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: K02439, thiosulfate sulfurtransferase [EC: 2.8.1.1] (inferred from 99% identity to sei:SPC_3594)

MetaCyc: 82% identical to thiosulfate sulfurtransferase GlpE (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]; 2.8.1.- [EC: 2.8.1.1]

Predicted SEED Role

"Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 2.8.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF588 Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEQFECITVEEAYQKLHQGAAVLVDIRDPQSYAMGHAPQAFHLTNDTLGAFMREHGFDTA
VMVMCYHGNSSKGAAQYLLQQGYDAVYSIDGGFEAWHRRFPADVANGA