Protein Info for GFF5878 in Variovorax sp. SCN45

Annotation: 16S rRNA (cytosine(967)-C(5))-methyltransferase (EC 2.1.1.176)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase" amino acids 83 to 431 (349 residues), 274.5 bits, see alignment E=9.7e-86 PF22458: RsmF-B_ferredox" amino acids 133 to 204 (72 residues), 82.2 bits, see alignment E=2.5e-27 PF01189: Methyltr_RsmB-F" amino acids 243 to 428 (186 residues), 178.4 bits, see alignment E=1.4e-56

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 91% identity to vpe:Varpa_0646)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF5878 16S rRNA (cytosine(967)-C(5))-methyltransferase (EC 2.1.1.176) (Variovorax sp. SCN45)
LTAVALASIRAGTSGSVAFEAVEPALRPGVQALGFQVLRWLGRAEALRRHLAKRTPPPLP
DALLCTALALAWDGTRAPYEPFTLVDQAVEAAKRNPATRAQASFINACLRRFLRERDELV
AVTDSEPVAQWNHPRWWIERLKRDHPRDWQRVLAADNAQAPMTLRVNARKSTAASYLVEL
EAAGLSATRVGPSGLQLARARPVQQLPGFAEGASSVQDAAAQMAAPLLLEGLLPAAPGGV
PLRVLDACAAPGGKTAHLLELAGPDAIDVTALEVDAVRSRRIDETLARIGLKARVLVADA
ARPADWWDRTPFDAILLDAPCTASGIVRRHPDVRWLRRESDTAQLSAQQAALLAALWPLV
RTGGRLLYCTCSVFREEGSQQIDAFLVHNTDARLLPSPGHLLPQSGSNARGVPDNPSGDH
DGFFYALLEKRPH