Protein Info for GFF5876 in Variovorax sp. SCN45

Annotation: Nitrogen regulation protein NtrY (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 63 (28 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details PF00672: HAMP" amino acids 311 to 361 (51 residues), 35.9 bits, see alignment 2.3e-12 PF00989: PAS" amino acids 380 to 427 (48 residues), 23.9 bits, see alignment 1.1e-08 PF00512: HisKA" amino acids 510 to 578 (69 residues), 45.8 bits, see alignment E=1.5e-15 PF02518: HATPase_c" amino acids 620 to 732 (113 residues), 77.1 bits, see alignment E=4.3e-25

Best Hits

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_0648)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (756 amino acids)

>GFF5876 Nitrogen regulation protein NtrY (EC 2.7.3.-) (Variovorax sp. SCN45)
MRWAIGVGAALVTAIGLVLMFLLAQATNNRALYERYYVRLFGINVVVAVLLVLVIGWVAF
RLLRRLRQGKFGSRLLIKLAAIFALVGVVPGALVYVVSYQFVARSIESWFDVKVEGALDA
GLNLGRATLDSLSDDLAAKTRSASGQLAQVPDASAGLVLERIRDQLEATDVILWTGSGQL
VASAGSSRFQLNPDRPTAQQFRQVRPERAVAHIEGLDETAMPGAAPPVASVRALAMVQRP
GFDFDTAPRYLQVTRPLPPAVVANALAVQEANREYQERALAREGLRRMYIGTLTLSLFLA
VFGAVLLAVLFGNQLARPLLVLADGVRQVAAGDLRPTAVLQGKDELGGLTRSFAVMTQQL
ADARGAVEKTMGQLDAARANLQTILDNLTSGVIVLDAKGTVLSTNPGATRVLRAPLAAYE
GQSLVDVPGLAEFGAKVQQQFDEFLVERMQHGLDHWQHAFELHASGQDMPQQDGAINIVA
RGAELPGAARLLVFDDISEIVSAQRAQAWGEVARRLAHEIKNPLTPIQLSAERLEMKLSG
KVQPPEQAVLVKSVKTIVDQVDAMKRLVNEFRDYARLPAADLKPVDLNALLVDVLQLYNA
ESLPIVLRSELDERCPPIRGDAQQIRQVIHNLLQNAQDAAEAAASGTGKRGEVVIRTRLG
DSGRRVRLTVQDSGPGFAENILKRAFEPYVTTKTKGTGLGLAVVKKIADEHGARIELSNR
VVDGAVAGAQVSLSFALASEPRAAVAHTEDSKSSAA