Protein Info for GFF5872 in Variovorax sp. SCN45

Annotation: Inner membrane protein YbhQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 61 to 86 (26 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 254 to 281 (28 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 34 to 310 (277 residues), 58.4 bits, see alignment E=4.2e-20

Best Hits

Swiss-Prot: 44% identical to YBHN_ECOLI: Inner membrane protein YbhN (ybhN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 80% identity to vpe:Varpa_1810)

Predicted SEED Role

"Inner membrane protein YbhQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF5872 Inner membrane protein YbhQ (Variovorax sp. SCN45)
MNTHAAAIADTPAHAGSRISSIWQRCRRWALPLFGIAVLGLLLSHAHKIDWAGAWQALQR
YSPLLLLSVLGLATASHMLYGCFDLIGKRHLQHRLPYWRTWAIAVTSYAFNLNLGSLVGG
IAMRARLYARAGLDDATVAQIVGLSLATNWLGYGLLAGGLFAAGAIVPPSQAHVGAGTLR
LLGVAMILLALAYVAACAFARGREWRFRGRRLQLPAARLAVVQLALSTTNWALMGAAMYL
LLGQKVPYATTMGVLLAASIVGVLTPIPAGLGVLEAVYLALLSGTVKQGALMGAVLAYRA
LYYLLPLAGGLALYLFLERYASSHSAEETSGDITPPLPTPVASA