Protein Info for GFF5866 in Variovorax sp. SCN45

Annotation: Aspartate racemase (EC 5.1.1.13)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF01177: Asp_Glu_race" amino acids 26 to 227 (202 residues), 101.6 bits, see alignment E=2.9e-33 TIGR00035: aspartate racemase" amino acids 47 to 232 (186 residues), 108.2 bits, see alignment E=2.4e-35

Best Hits

KEGG orthology group: K01779, aspartate racemase [EC: 5.1.1.13] (inferred from 74% identity to pol:Bpro_4755)

Predicted SEED Role

"Aspartate racemase (EC 5.1.1.13)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 5.1.1.13)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.13

Use Curated BLAST to search for 5.1.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>GFF5866 Aspartate racemase (EC 5.1.1.13) (Variovorax sp. SCN45)
MTIDTLHIGVVGCSAEGAALCYRTLCVEGARYLGQPHAHPEVSVHTHSLASYVDCLDSGD
IDGVAQLMLSSARKLAAAGADFLICPDNTIHQAMHRVLPQSPLPWLHIAEVVAAEAASRG
FRRVGVLGTRWLVDSEVYPRALSDAGLVAVRLDAAERAEVGRIIMDELVCGVFRPESTAV
LQRMIEELKAHGCDAVALGCTELPLVLNDGNSALPTLDSTRLLAHAALRRATAG