Protein Info for GFF5858 in Variovorax sp. SCN45

Annotation: heme uptake regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 13 to 167 (155 residues), 67.4 bits, see alignment E=5.7e-23 PF04542: Sigma70_r2" amino acids 15 to 82 (68 residues), 38.9 bits, see alignment E=1.5e-13 PF07638: Sigma70_ECF" amino acids 40 to 159 (120 residues), 25.4 bits, see alignment E=3.2e-09 PF08281: Sigma70_r4_2" amino acids 114 to 166 (53 residues), 60.9 bits, see alignment E=1.8e-20 PF04545: Sigma70_r4" amino acids 119 to 165 (47 residues), 28.8 bits, see alignment E=1.7e-10 PF13384: HTH_23" amino acids 125 to 158 (34 residues), 26.2 bits, see alignment 1.4e-09

Best Hits

Swiss-Prot: 49% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 62% identity to mms:mma_3497)

MetaCyc: 49% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>GFF5858 heme uptake regulator (Variovorax sp. SCN45)
MVAGEPALQQQVHALYSDHHGWLFGWLRGRLGNSFDAADIAHDTFMRVLVGLRADAIPTL
REPRAYLTTVAKRLVINHGQRQSLERAYLASLALLPEATVPSVEERAILLETLHELDALL
DELPARARTAFLLSQLEGLSYDDIAARLQVSVRTVTRYMAQGFAQCLRLMLAQQP