Protein Info for GFF5854 in Variovorax sp. SCN45

Annotation: Type I secretion system, outer membrane component LapE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 62 to 458 (397 residues), 245.8 bits, see alignment E=4.3e-77 PF02321: OEP" amino acids 70 to 248 (179 residues), 77.5 bits, see alignment E=5.5e-26 amino acids 279 to 437 (159 residues), 69.7 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: None (inferred from 69% identity to vpe:Varpa_5039)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>GFF5854 Type I secretion system, outer membrane component LapE (Variovorax sp. SCN45)
VKARTTLPALAWLALAAAAGPVHADDDGGLKLARRLAPSSLARELELKPGRPLPQAQAST
QPLTLNEAVRQSVARHPSISDAISTLAQQAGGVDVARAGYYPQVRVGVGGGTSNAPASQG
GSTGTVASASVSQMLYDFGKVGGAVAQSQALVQRQQAAILKQIDAVAQQAAEAVVMAHRY
QSLLAIAQDQVQAVQAVLETARLRANAGLSTKADPIQAESRVDSARANLLQVKSQLAQWR
ERLGTLLGPGVVPPELAPLPDDLARALSVDAQPDASLLPDVLAAEAERRAASAQLEVARA
NRYPTLTVDAAVNKAMGGINPATLERNGTYHTVMLNLTSVIYQGGALDAQVRAATAAEDA
ARMRIETARLNAGDQARNYREQVVGAQARLGVLADRRRSIVEARDLYREQYTLGTRSILD
LLNAEQEIYQAAAEQEAVVHDLWASRVGYIGATGQARAFYGLDNTTVQGMELLP