Protein Info for GFF5852 in Variovorax sp. SCN45

Annotation: Type I secretion membrane fusion protein, HlyD family @ Type I secretion system, membrane fusion protein LapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 55 to 360 (306 residues), 32.6 bits, see alignment E=1.2e-11 PF13533: Biotin_lipoyl_2" amino acids 88 to 122 (35 residues), 31.4 bits, see alignment 2.5e-11 TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 212 to 418 (207 residues), 215.5 bits, see alignment E=6.7e-68 PF16576: HlyD_D23" amino acids 227 to 349 (123 residues), 32.4 bits, see alignment E=1.2e-11 PF13437: HlyD_3" amino acids 269 to 375 (107 residues), 61 bits, see alignment E=3.4e-20

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 78% identity to vpe:Varpa_5037)

Predicted SEED Role

"Type I secretion system, membrane fusion protein LapC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>GFF5852 Type I secretion membrane fusion protein, HlyD family @ Type I secretion system, membrane fusion protein LapC (Variovorax sp. SCN45)
MAMPDAMPDIPLGPPPATRQEGEKKSKEAKAAQGRYAPVEPPLPGASLVVWIVAAMLAAL
LAWAWFFKLDEVSTGTGKVVPSSREQMIQSLEGGILVDLKVREGDIVSAGQVLAQLDRTK
TESTVQESASRVRAALAMSARLTAEVNGTPLVFPDEVRGEPGLVRTETALYQSRREQLAS
SLAGVNQALVLMRRELALTEPLVSRGAASDVEVLRLKRQINEAETKAADLRSQYYVKARE
DLAKANAEIEAQRSVTRGRSDSLTRLTFASPVRGIVKDIVVTTVGGVLPPGGKLMEIVPL
DEKLLVEARISPRDVAFIHPGQDATVKVTAYDYAIYGGLPGKVTTISPDTIQDDVKRDVY
YYRVYIRTDADHLKNRSGRSFPIVPGMIATVDIHTGSKTVLDYLIKPLNKASEALRER