Protein Info for GFF585 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 200 to 231 (32 residues), see Phobius details amino acids 238 to 269 (32 residues), see Phobius details amino acids 290 to 321 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 16 to 325 (310 residues), 181.7 bits, see alignment E=1.2e-57

Best Hits

KEGG orthology group: None (inferred from 80% identity to xau:Xaut_4286)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>GFF585 hypothetical protein (Xanthobacter sp. DMC5)
MVSDRDVARRVAIACIVIALGWLSWKIYDVILQVFAACLVSLALHALAEPFAKWTRFPER
YAVIPVGIIVFGGLGLSLYLFGSTIQTQVTQLVNELPTAWSAFEQRFHLEGMSDDLLKRA
EAAAPSGETVLSFVQGFTSNLFQVVLGTFLVVVGGIYFAVSPELYRRMFLSLWRPSERPA
AARRLAMVSEDLRHFLKAQLIAMVVVGVLTFIGLTVVGVPSSLALALFAGLAEFVPMIGP
VMAAAPAVLIALTMGADTGLWTLLVFVGVQQAESNIITPLLQQRMVSLPPAVTLFAVVAF
GSIFGALGVVLATPLTVVAFAAFKAHSEQLAEEDAAA