Protein Info for GFF5841 in Variovorax sp. SCN45

Annotation: Auxin efflux carrier family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 267 to 300 (34 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 9 to 135 (127 residues), 55.1 bits, see alignment E=2.4e-19 amino acids 163 to 335 (173 residues), 67.3 bits, see alignment E=5e-23

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 87% identity to vpe:Varpa_0741)

Predicted SEED Role

"Auxin Efflux Carrier"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>GFF5841 Auxin efflux carrier family protein (Variovorax sp. SCN45)
VLPVFLVTFPFFALIAAGYGAARARILPLDAIPGLNAFVLYFALPCMLLRFGAGTPIGQL
LDGSVALVWGLGALVVVAGVVMFTRNARVGWNDGAFGALVAAFPNTGFMGVPLLVAILGA
QAAGPMIIAIAFDMVVTSSLCIGLSRLDGVGAGAAGGGAAQAARKALRGILVNPMPWSIL
LGVLLSAARWQLPGPLERTVAMLADAASPVALFTIGAVLARSALLAREHDASAAVAEALL
GTGVQPAPRAPWSDVLPVVAVKLLVHPLLIWGLGLGAIALGLPLAPAALVVMVLVAALPS
ASNVSMLAERFGADNGRIARIILWTTVVAFFSFPLAVGLLH