Protein Info for PS417_02970 in Pseudomonas simiae WCS417

Annotation: acetyl-CoA carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein" amino acids 1 to 153 (153 residues), 190.8 bits, see alignment E=1e-60 PF00364: Biotin_lipoyl" amino acids 81 to 153 (73 residues), 90.1 bits, see alignment E=3.4e-30

Best Hits

Swiss-Prot: 78% identical to BCCP_PSEAE: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 96% identity to pfs:PFLU0618)

MetaCyc: 61% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC74 at UniProt or InterPro

Protein Sequence (154 amino acids)

>PS417_02970 acetyl-CoA carboxylase (Pseudomonas simiae WCS417)
MDIRKVKKLIELLEESGIDELEIKEGEESVRISRHSKTPAQQFYAPQMQAPAPAAAAPAA
APAAAAAPAAPAAPALNGFVVKSPMVGTFYRTPAPTSPAFVEVGATVKVGDTICIVEAMK
MMNHITAEKAGVIESILVENGQPVEYDQPLFTIV