Protein Info for GFF5837 in Variovorax sp. SCN45

Annotation: Helicase PriA essential for oriC/DnaA-independent DNA replication

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 726 PF17764: PriA_3primeBD" amino acids 34 to 132 (99 residues), 43.3 bits, see alignment E=8.2e-15 PF04851: ResIII" amino acids 168 to 328 (161 residues), 49.1 bits, see alignment E=1.9e-16 PF00270: DEAD" amino acids 171 to 331 (161 residues), 68.1 bits, see alignment E=2.4e-22 TIGR00595: primosomal protein N'" amino acids 187 to 723 (537 residues), 501.5 bits, see alignment E=1.2e-154 PF18319: Zn_ribbon_PriA" amino acids 421 to 447 (27 residues), 33.5 bits, see alignment (E = 9.9e-12) PF00271: Helicase_C" amino acids 485 to 571 (87 residues), 27.3 bits, see alignment E=1.1e-09 PF18074: PriA_C" amino acids 623 to 723 (101 residues), 54.1 bits, see alignment E=7.1e-18

Best Hits

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 94% identity to vpe:Varpa_0745)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (726 amino acids)

>GFF5837 Helicase PriA essential for oriC/DnaA-independent DNA replication (Variovorax sp. SCN45)
VPRRPSIATAAHSLDGTSQPTNGSPPTLPWRLDIAVQTPAHAALGDLLSYASAGPLPPGT
LVRVPLGKREVLGVVWNEPVSLEGAEPDMALKPVGAALDALAPLGEAWRDLVAFAGRYYQ
RSIGEIALAALPPQLRDLTTTQLARRLKRKTTAGPVAETAESANLIALSAEQTAALERIE
AASGTFLLVGSTGSGKTEVYLRCVADLLAREPEAQALVMVPEINLTPQLEARFKARFGEE
AVVSLHSGMTNPQRLASWLAAHSGGARIVLGTRMAVFASIPGLKLIVVDEEHDPSYKQQE
GARYSARDLAVWRGQREGAKVILGSATPSFESWHQSRPAEGDDPGGRYVRLAMPSRIGAG
ELPAVRLVDMNLQPPKTVISGALLDAIGQRIARGEQSMIFLNRRGYAPVLACGDCGWKSE
CPHCSAYRVFHKIDRTLRCHHCGFTERVPRACPACGNPDIAPVGRGTERLEEHLAELFAA
VKRPDGGAVRIARIDADSTRKQGALESQLAAVHSGEVDVLVGTQMIAKGHDFRRITLVAA
VNPDGALFSSDFRAPERLFSLLMQSAGRAGRDAAYLASQGATAEMWIQTHHAQHPLFMAL
RQHDYAVFARQQLDERRAAGMPPFAFQALLRADAREQSVAQAFLNIAADQAEALPGADLV
TRYPAVPLAIQRVANVERAQMLIESPSRAALQRLLAGWQPLLHELRRTPEGKGVIRWLVD
VDPHSI