Protein Info for GFF5827 in Variovorax sp. SCN45

Annotation: FIG00452956: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 55 to 56 (2 residues), see Phobius details amino acids 58 to 98 (41 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 273 to 298 (26 residues), see Phobius details amino acids 309 to 335 (27 residues), see Phobius details PF02653: BPD_transp_2" amino acids 57 to 325 (269 residues), 97.6 bits, see alignment E=3.6e-32

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 72% identity to bmn:BMA10247_2712)

Predicted SEED Role

"FIG00452956: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>GFF5827 FIG00452956: hypothetical protein (Variovorax sp. SCN45)
MSSAYSTIAEAMPVQEVLPASLAEASRRARISLAVMVGSVLLIGLVVPWLANAYWIKTLT
SSLALSIAAAGVALLYGQLGLVSLCQYALLGAGGWIALRAGHGLGWPFELSVLAGGLLSC
VVGMLAGLPALRLKGLYLALVTMMMAGGFQVVINVTGFPDGGAGWLGRVFGSERLMMPRP
ALALTDAAYFRYVAVWLAVVLVLIELHRRTRAGRSWALIRRGEAAAVAAGVNILRYQTWA
FGLAGFCAGVAGALLAGGVGQLDGRAFTAGDSVMLFALTVVGGVYHWAGALIAGLLLRAV
PALLTDFGVNGYLAMIFFGLALLHALITAPSGIAGQLAGLVESVRKRLPGAGKDATP