Protein Info for GFF5824 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 146 to 172 (27 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 358 to 382 (25 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 375 (348 residues), 129.2 bits, see alignment E=9.1e-42 amino acids 229 to 416 (188 residues), 45.8 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 88% identity to pna:Pnap_3763)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>GFF5824 Nitrate/nitrite transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPRVEKDIMASELNNEKKAWSVLLVSTLAFTVCFMVWMMFGVIGIPIKKALDLNSTQFGL
LMATPVLTGSLVRVPLGIWTDRYGGRIVMALLMATTVPAILLMSYATAYWHFLTIGLFVG
LAGGSFSVGTPYVARWFPKHRQGMAMGVYGAGNSGAAVNKFVAPVLLVAFGWTMVPQVYA
AIMLGTVVLFWLFTYSNPDHLVPSNVSFMDQLKALKDPKVIKYCQYYSIVFGGYVALSLW
MVQYYVGEFGLDIRVAALLAACFSLPGGVLRAVGGVMSDKFGAHKVTWWVLWVSWICLFL
LSYPQTDFTVATVDGPKTFHIGLNVYLFTGLMFILGIAWAFGKASVFKYISDDYPKNIGA
ISGIVGLAGGLGGFVLPILFGMLMDLTGIRSSAFMLMYGVVWVSLIWMYWTEVRQTEVMG
ANAKPFSLQN