Protein Info for PS417_02960 in Pseudomonas simiae WCS417

Annotation: ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF06325: PrmA" amino acids 2 to 291 (290 residues), 339.8 bits, see alignment E=4.1e-105 TIGR00406: ribosomal protein L11 methyltransferase" amino acids 3 to 285 (283 residues), 304.6 bits, see alignment E=3.7e-95 PF05175: MTS" amino acids 142 to 229 (88 residues), 35.5 bits, see alignment E=2e-12 PF13847: Methyltransf_31" amino acids 159 to 258 (100 residues), 31.7 bits, see alignment E=3e-11 PF13649: Methyltransf_25" amino acids 161 to 250 (90 residues), 27.6 bits, see alignment E=9.6e-10

Best Hits

Swiss-Prot: 100% identical to PRMA_PSEFS: Ribosomal protein L11 methyltransferase (prmA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to pfs:PFLU0616)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6C8 at UniProt or InterPro

Protein Sequence (292 amino acids)

>PS417_02960 ribosomal protein L11 methyltransferase (Pseudomonas simiae WCS417)
MPWLQVRLAISPEQAETYEDAFLEVGAVSVTFMDAEDQPIFEPELNTTPLWSHTHLLALF
EDGTDAAAVLAHMELLTGGPLPEHHSEVIEDQDWERSWMDNFQPMRFGQRLWIVPSWHAA
PEPDAVNLLLDPGLAFGTGTHPTTALCLEWLDGQDLTDSHVLDFGCGSGILAIAALLLGA
KEAVGTDIDVQALEASRDNAGRNNIPEGKFPLYLPEQLPQVQADVLVANILAGPLVSLAP
QLSSLVKPGGRLALSGILAEQGEDVAAAYAKDFELDPIANRDGWVRISGRRR