Protein Info for GFF5800 in Variovorax sp. SCN45

Annotation: Urea ABC transporter, permease protein UrtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 222 to 246 (25 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details amino acids 447 to 473 (27 residues), see Phobius details amino acids 479 to 499 (21 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 219 to 511 (293 residues), 425.7 bits, see alignment E=5.6e-132 PF02653: BPD_transp_2" amino acids 222 to 497 (276 residues), 135.2 bits, see alignment E=1.2e-43

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 96% identity to vpe:Varpa_4650)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>GFF5800 Urea ABC transporter, permease protein UrtB (Variovorax sp. SCN45)
MLLMASAAHALTADEARAIASGDSEARIAALNKAVLTADDKTAAFIQAMSDDAVKYTEDK
VFVMKDDKGYDPVTGAELKVPDTAEDVVNNNLMRGALDAAQAALKLSSKDDAVRAEAAQA
LFKEPDESRIPMVEKALAAETNPKIKAQLELVRAASMLGSADKAKRLAAAKELGNNRNPD
TKLLLNQRLADETDADVKAAIVTSIASIDGALVWGDRINAVFSGVSLGSVLLLAALGLAI
TYGLMGVINMAHGELMMIGAYATYVMQGIFQKYMPEAAFGWYLVAAIPVSFMASALVGAV
LERGVIRFLYGRPLETLLATWGISLMLQQLVRSLFGAQNVGVENPGWMSGGFTMLSNVTL
PWNRICIIIFAALVLLAMGWLIGRTRLGLFVRGVTQNRPIASCMGVNTARIDTYAFALGS
GIAGLAGCALSQIGNVGPDLGQSYIVDSFMVVVMGGVGQLAGTVYAALGLGILNKFIEGW
AGAVLAKIAVLVFIIIFIQKRPQGIFAMKGRSAEA