Protein Info for GFF580 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional regulator, ArsR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF09339: HTH_IclR" amino acids 10 to 59 (50 residues), 46.2 bits, see alignment 3.3e-16 PF01614: IclR" amino acids 123 to 248 (126 residues), 121.6 bits, see alignment E=2e-39

Best Hits

Swiss-Prot: 39% identical to XYNR_ECOLI: HTH-type transcriptional regulator XynR (xynR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to sec:SC3463)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF580 Transcriptional regulator, ArsR family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKITTSIPALDKIMRVFAYLLECDGATFTQIHQNSGIAKSSTSSLLNGMVEHGLLRQEK
DKYYLGLRLYELGNKAAEQYDIKKIALPILEEIRDNTGLTCHLGVLEGDAPIYLLKVESP
QAIVIRSWEGKRLSLHSSGLGKVLIAWLSGEELEELLPPDQILTRFTDTTITDVNILKQE
LAGIRRRGWGYDNEEDSLGVRCIAVPVFNTQGKVIAALSVSGVTFQIPDDKRESLATLMM
DASRSLTRLMC