Protein Info for GFF58 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tyrosine-protein kinase EpsD (EC 2.7.10.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR03029: chain length determinant protein tyrosine kinase EpsG" amino acids 12 to 284 (273 residues), 333.2 bits, see alignment E=1e-103 TIGR01007: capsular exopolysaccharide family" amino acids 93 to 285 (193 residues), 118.3 bits, see alignment E=3.2e-38

Best Hits

KEGG orthology group: K00903, protein-tyrosine kinase [EC: 2.7.10.-] (inferred from 53% identity to nmu:Nmul_A0244)

Predicted SEED Role

"Tyrosine-protein kinase EpsD (EC 2.7.10.2)" (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.10.-, 2.7.10.2

Use Curated BLAST to search for 2.7.10.- or 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF58 Tyrosine-protein kinase EpsD (EC 2.7.10.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNAPMDFKPQGAIGDILVARGLLLPADVERVVARQASHDEPFGEAAIALKLLDRADLDAA
LSTQFNYGYLQDEDAPLSRELVTAFKPFSRASEEMRALRGQLMLRWFNDDRRRRLLTVVS
QRPRDGRSFIAANLAVVFSQQGQRTLLIDANLREPHQAKMFHTTGHSPGLAGILAGRAGL
EVIESVPGLPGLRVLPAGAAPPNPQELVGMPSFGALLQQVSQNHDVVLIDTPASERFADA
EIIAARTGAALLVARRHRSPLGGLGDLSRRLQDTGVALVGSVLNHY