Protein Info for GFF5795 in Variovorax sp. SCN45

Annotation: esterase, PHB depolymerase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 166 to 185 (20 residues), see Phobius details amino acids 226 to 239 (14 residues), see Phobius details amino acids 258 to 275 (18 residues), see Phobius details PF10503: Esterase_PHB" amino acids 67 to 259 (193 residues), 139.3 bits, see alignment E=3.4e-44 TIGR01840: esterase, PHB depolymerase family" amino acids 70 to 270 (201 residues), 109.9 bits, see alignment E=6.2e-36 PF00756: Esterase" amino acids 78 to 199 (122 residues), 29.7 bits, see alignment E=1.7e-10 PF02230: Abhydrolase_2" amino acids 84 to 206 (123 residues), 35.5 bits, see alignment E=3e-12 PF00326: Peptidase_S9" amino acids 133 to 262 (130 residues), 46.1 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_4655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF5795 esterase, PHB depolymerase family (Variovorax sp. SCN45)
MARRSTASVFARAYERNLKALTRLTLSNSKRVAGQVQRATAKRLKPPPGRGDWLSGVAVG
AGGARGYHLFRPAGLQLAPGEKLPLMVMLHGCGQTGRDFAASTRMNALAVRQRFLVLYPE
QDRLAHPQGCWNWYERRSGKADAEAATLMAAVDQACMLYPVDRDRVALAGLSAGASMAAL
VATRYPNRFRAVVMHSGVAPGAAKSSATALGAMRGQNVPPMPVTAVGKAMGAAAVFTTLP
PMLVLHGDADAVVAPSNAVSSAAVWATAMGARPGLPRDLQRGKRRLMRVTDFKRKGRTLV
TLCEISGLGHSWSGGASKLLFSDPSGPDATRMTWAFATAQFKLADKA