Protein Info for GFF5793 in Variovorax sp. SCN45

Annotation: Low-affinity inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 108 to 136 (29 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 176 to 192 (17 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 428 to 448 (21 residues), see Phobius details amino acids 520 to 541 (22 residues), see Phobius details PF01384: PHO4" amino acids 85 to 534 (450 residues), 293 bits, see alignment E=1.5e-91

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 91% identity to vpe:Varpa_4657)

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>GFF5793 Low-affinity inorganic phosphate transporter (Variovorax sp. SCN45)
MNTLAAPNADTPHGPASAASRPKLDAKPGPLTLITFVGLLAAGLLFTAWSLIGDVTASGV
PVTTWVPYILLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPNFAVVWSGFFNFLGV
LVSSGAVAFGIIALLPVELILQVGSSAGFAMVFALLIAAIIWNLGTWWLGLPASSSHTLI
GSIIGVGVANALMHGRDGTSGVDWGQATKVGYSLLLSPMVGFGCAALLLLALRAFVKNRA
LYEEPKGSEPPPLWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTVPMAYALNRAM
PASETIKFVAVTEMAQTALNRSVPTSLPALQPEAARETLSTYVRTREFNASVVPALAAAA
GSIGQQVKAHGSLAGVPADSVANVRNDMYLASEAIRNLEKSGAAKFDEETKLRIGTFREE
LDTATRFIPLWVKVAVAIALGLGTMIGWKRIVVTVGEKIGKTHLSYAQGASAEVVAMLTI
GAADMYGLPVSTTHVLSSGVAGTMTASGSGLQMSTLRNLALAWVLTLPVAMLLSGSLYWL
FTRIF