Protein Info for GFF5780 in Variovorax sp. SCN45

Annotation: Positive regulator of L-idonate catabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00356: LacI" amino acids 1 to 47 (47 residues), 47.3 bits, see alignment 2.8e-16 PF00532: Peripla_BP_1" amino acids 63 to 310 (248 residues), 98.3 bits, see alignment E=1.1e-31 PF13407: Peripla_BP_4" amino acids 65 to 313 (249 residues), 53.9 bits, see alignment E=4e-18 PF13377: Peripla_BP_3" amino acids 169 to 336 (168 residues), 110.3 bits, see alignment E=2.2e-35

Best Hits

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 92% identity to vpe:Varpa_2276)

Predicted SEED Role

"Positive regulator of L-idonate catabolism" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF5780 Positive regulator of L-idonate catabolism (Variovorax sp. SCN45)
MADVAARVGVSKMTVSRALNRSVGSDRVTSQALRERILQACEEMGYVIDQTARTFSSKRS
GFVAALIPSLNNSNFSETVQGITAAVEAHGLQLLLGYTDYRMETEERLLRAMLARRPEGV
ILTGGSHTPAARAMLQAAGVPVIETWDLPATPIGHTVGFSNAEAAAAMVRHLHGKGYRRI
AFIGGTSNRDTRGADRQRGYAQAIRELGLPDGRVISFGQPPISMAQGGEAVAQLVRQWPD
VDAVLCVSDLSAFGALMECQRQGWDVPGRIAIAGFGDFEVARACHPRITTVAVDCVGIGK
AAGELLLRVIDGAQDGHRPPSETVMIPFHIEQRESS