Protein Info for GFF5771 in Variovorax sp. SCN45

Annotation: Flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 312 to 329 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 24 to 695 (672 residues), 901.8 bits, see alignment E=1.4e-275 PF00771: FHIPEP" amino acids 32 to 686 (655 residues), 900.6 bits, see alignment E=3.5e-275

Best Hits

Swiss-Prot: 67% identical to FLHA_SALTY: Flagellar biosynthesis protein FlhA (flhA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 88% identity to vap:Vapar_4141)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (699 amino acids)

>GFF5771 Flagellar biosynthesis protein FlhA (Variovorax sp. SCN45)
MNAMTNLLRLPTQMFSGSQFKGLAGPILIIMILSMMVLPLPPFLLDLLFTFNIAMSVMVL
LVSMYTMKALDFAAFPAVLLFSTLLRLSLNVASTRVVLMHGHTGPDAAGKVIEAFGHFLV
GGNFAVGVMVFIILVLINFMVITKGAGRIAEVGARFMLDAMPGKQMAIDADLNAGLIGEE
VARKRRQEVAQEADFYGSMDGASKFVRGDAIAGLLIMVINIIGGLIVGMVQHGLDFSTAG
KTYTLLAIGDGLVAQIPALVISTAAGVIVSRVTTDEDVGSQLTGQLFANPQVLFLTAGIV
GLLGMIPGMPNLAFLLIAGGLVWLGRRLVKRKPQQQAAQEAAAAQAATLAPGGEMAEATW
DDVAMVDPLGMQVGYRLIPLVDQSQQGELLGRIKSIRKKIAQDIGFLVPVVHIRDNLEIK
PNTYVISLKDVEIGRGEAFPNQWMAINPGQVSGTLPGAPTRDPAFGLPAVWIDASQRQQA
QVYGYTVVDACTVMATHLNHLIQTHAAELLGRQEVQQLLDQIAKTAPKLTEDLVPKVLSL
STLHKVLQNLLDEEVPIRDMRTILDVMAEHAPTIKDPTELTTLTRLALGRAITQQLFPGD
AEMQVIGLDGALDGVLQQALSNSGGIEPGIADNLLHQAQAAIQRQEQMGLAPVLVVQHSL
RVLLSRFLRRSLPQLKVLSHAEIPDSRTIKITAAIGGRG