Protein Info for PS417_02935 in Pseudomonas simiae WCS417

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 422 (422 residues), 594.6 bits, see alignment E=5e-183 PF02844: GARS_N" amino acids 1 to 101 (101 residues), 126.5 bits, see alignment E=1.3e-40 PF01071: GARS_A" amino acids 102 to 295 (194 residues), 279 bits, see alignment E=4.5e-87 PF02786: CPSase_L_D2" amino acids 108 to 203 (96 residues), 22.4 bits, see alignment E=1.6e-08 PF02843: GARS_C" amino acids 330 to 420 (91 residues), 114.8 bits, see alignment E=3.8e-37

Best Hits

Swiss-Prot: 94% identical to PUR2_PSESM: Phosphoribosylamine--glycine ligase (purD) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 99% identity to pfs:PFLU0611)

MetaCyc: 75% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1K0 at UniProt or InterPro

Protein Sequence (430 amino acids)

>PS417_02935 phosphoribosylamine--glycine ligase (Pseudomonas simiae WCS417)
MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA
EKNVSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTAD
YQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLAGNAFGDAG
SRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTA
DVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVML
RLQSSLVLLVEAALAQALDKVEAQWDPRPSVGIVLAAGGYPADYAKGDVIEGLDAAATLE
GKVFHAGTALKDGQVVTAGGRVLCATAMGASVDAAQQQAYQLAAKIDWKGCFYRKDIGYR
AIARERGESQ