Protein Info for GFF577 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 334 to 346 (13 residues), see Phobius details TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 21 to 397 (377 residues), 517.1 bits, see alignment E=1.2e-159 PF00483: NTP_transferase" amino acids 22 to 291 (270 residues), 236.1 bits, see alignment E=9e-74 PF12804: NTP_transf_3" amino acids 22 to 167 (146 residues), 29.4 bits, see alignment E=1.7e-10 PF24894: Hexapep_GlmU" amino acids 314 to 417 (104 residues), 140.3 bits, see alignment E=4.4e-45

Best Hits

Swiss-Prot: 100% identical to GLGC_SALEP: Glucose-1-phosphate adenylyltransferase (glgC) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 100% identity to sty:STY4274)

MetaCyc: 92% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>GFF577 Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVSLEKNDRVMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSN
CLNSGIRRIGVITQYQSHTLVQHIQRGWSLFSEEMNEFVDLLPAQQRMKGENWYRGTADA
VTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIKEATAFGV
MAVDESDKIIDFVEKPANPPAMPGDASKSLASMGIYVFDADYLYELLAADDKDDASSHDF
GKDIIPKITREGMAYAHPFPLSCVQSDPQAEPYWRDVGTLEAYWKANLDLASVTPELDMY
DQNWPIRTHMESLPPAKFVQDRSGSHGMTLNSLVSGGCIISGSVVVQSVLFPRVRINSFC
NIDSAVLLPEVWVGRSCRLRRCVIDRACIIPEGMVIGENAEEDARRFYRSEEGIVLVTRE
MLRKLQVKQER