Protein Info for GFF5766 in Variovorax sp. SCN45

Annotation: Chemotaxis protein CheD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF03975: CheD" amino acids 69 to 173 (105 residues), 107.5 bits, see alignment E=1.9e-35

Best Hits

Swiss-Prot: 62% identical to CHED_CUPMC: Probable chemoreceptor glutamine deamidase CheD (cheD) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03411, chemotaxis protein CheD [EC: 3.5.1.44] (inferred from 71% identity to vap:Vapar_4153)

Predicted SEED Role

"Chemotaxis protein CheD" in subsystem Bacterial Chemotaxis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF5766 Chemotaxis protein CheD (Variovorax sp. SCN45)
MTHSSPSAPDSVASHHYFDRDVGQMAVKLLPSEYYVTAGDTVLSTVLGSCVAACLHDAEA
GVAGMNHFMLPDDSESGMRDATDSMRYGTYAMDVLIRELVRAGARRDRLQAKVFGGGAVL
ANMTTLNIGDRNADFVLRYLRAERIEIAAQDLRGPHARRVYFLPVTGKAIVRKLRAQTEV
RSIQREEGELLRRLSGQRVVPEPEKTSNALAARAVPMAAIKGSR