Protein Info for PS417_02925 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 2 to 192 (191 residues), 124.5 bits, see alignment E=2.3e-40 PF01914: MarC" amino acids 3 to 195 (193 residues), 139.2 bits, see alignment E=6.4e-45

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to pfs:PFLU0609)

Predicted SEED Role

"membrane protein, MarC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U460 at UniProt or InterPro

Protein Sequence (198 amino acids)

>PS417_02925 membrane protein (Pseudomonas simiae WCS417)
MLHVLFSVYLKMLVLYSPFFVLSCFISLTRGYSSKERRRLAWKVALATLVSSVLLYLFGR
VIFSVFGITVDAFRIGAGSVLFISALGMAQGKSAVQTDNVQQDVTIVPLTIPLTVGPGTI
GALLVMGVSQPHWDDKITAILSIALASLTVGVVLYLSNRIERILGDQGLQIVSRLMGLFV
CALAAQIIFTGVRGYLVP