Protein Info for GFF5743 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable mdcF malonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 8 to 310 (303 residues), 107.6 bits, see alignment E=2.7e-35

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 60% identity to vpe:Varpa_4291)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>GFF5743 Probable mdcF malonate transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
VNIASHPVVASLTPVFILIGLGYLAGRLQWIRDAAVKDLSNLVFLLLIPALLFRTMSSVH
FQELDLRPIGAYFLAALSLLAVSIAWRGFNRGSVVLALAGTFSNMVMLGITLVELAYGKS
AQVTVLTLVSVHALILLTTGSIVLELAVAREARAGGQRAPHVLATAWSAFKGALIHPIPL
PILCGLLFAQTGLTLPTVVDRPLQLLGSAFGPIALVLVGVTLARTPMAGHLRQALWVSVS
KNLVLPLLVGLSAWALGITGMPLTVMVVAAALPVGANVFLFAQRYEVAQEVTTAAMGLST
VLALFTLSLVMTAMAWLN