Protein Info for GFF5741 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phosphinothricin N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF13302: Acetyltransf_3" amino acids 3 to 139 (137 residues), 35.8 bits, see alignment E=3.7e-12 PF13420: Acetyltransf_4" amino acids 4 to 158 (155 residues), 55.6 bits, see alignment E=2e-18 PF00583: Acetyltransf_1" amino acids 47 to 138 (92 residues), 54.3 bits, see alignment E=4.7e-18 PF13673: Acetyltransf_10" amino acids 50 to 146 (97 residues), 25.3 bits, see alignment E=4e-09 PF13508: Acetyltransf_7" amino acids 54 to 139 (86 residues), 33.5 bits, see alignment E=1.4e-11

Best Hits

Swiss-Prot: 54% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 78% identity to pol:Bpro_1689)

Predicted SEED Role

"Phosphinothricin N-acetyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF5741 Phosphinothricin N-acetyltransferase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPLIRPSRDEDLDAITRIYGHHVLHGTGTFETTPPSLAEMTARRADVLGKGLPWLVAEEG
GQVLGYAYGNWFKPRPAYRFSVEDSIYMDPTAHRQGLGRALLAELLAVLERTGTRKVMAV
IGDSANAGSIGVHKALGFEPVGVVQSCGWKFDRWLDIVLMQKTLGAGDSTPPTEGA