Protein Info for GFF5738 in Variovorax sp. SCN45

Annotation: Flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 74 to 108 (35 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 174 to 205 (32 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 17 to 254 (238 residues), 223.6 bits, see alignment E=1.5e-70 PF01311: Bac_export_1" amino acids 18 to 250 (233 residues), 227.9 bits, see alignment E=6.3e-72

Best Hits

Swiss-Prot: 49% identical to FLIR_PECCC: Flagellar biosynthetic protein FliR (fliR) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 75% identity to vap:Vapar_4180)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>GFF5738 Flagellar biosynthesis protein FliR (Variovorax sp. SCN45)
VTPSIFSVTSGQLEGWVVAFLWPFVRMLALVSTAPIFAESWVPRQVKVGIAAMLTLVISP
LIGPFPAVPVVSAGGLWIIVQQVLIGVAMGFAMRMVFTAVLAAGEYIGLQMGLSFASFYD
PMSRGSTMVVSRLLNMLATLIFLALDGHLLIVNALAESFQTLPISDGPLVAGGWMFLVLA
GGEIFASGLLLSLPLITALLTLNLAMGILNRASPQFSIFAVGFPLTLLAGIFMLQLLMPN
LGAFLEPRFAQGIANMLRFTQGLRP