Protein Info for GFF5735 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details PF03186: CobD_Cbib" amino acids 31 to 259 (229 residues), 67.1 bits, see alignment E=1.7e-22 PF17113: AmpE" amino acids 56 to 230 (175 residues), 21.4 bits, see alignment E=1.4e-08

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 59% identity to adn:Alide_1208)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.10

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF5735 Adenosylcobinamide-phosphate synthase (EC 6.3.1.10) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSFFAILIALLLEQARPLAFDNPVHAGLRGWARTVRRNLDAGQSSHGWVAWALAVGVPAA
IAGLVYWGLWQFSSVLAFVWTVGILYVTLGFRQFSHHFSEIRQALDVGDDAGAREKLARW
LRVDASSLPRTELLRQVIEQSVLAAHRHVFGVLVCFVVFWAIGLGPSGAVFYRMAEYISR
NWRARPDGTPSPALQHAAATAWRWVDHVPARMTALGFAVVGNFEEAVASWRGDAERFAPG
SDGVVLAATSGAINVRLTPQLDPLTIEDDEVVGDPGARPDPQLAHLSSVVGLVWRAVVLW
MLLLALLTLAGL