Protein Info for GFF5723 in Variovorax sp. SCN45

Annotation: Flagellar protein FlgJ [peptidoglycan hydrolase]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02541: flagellar rod assembly protein/muramidase FlgJ
  • amino acids 30 to 336 (307 residues), 356.8 bits, E=6.9e-111
• PF10135: Rod-binding
  • amino acids 68 to 114 (47 residues), 61.1 bits, 1.1e-20
• PF01832: Glucosaminidase
  • amino acids 201 to 337 (137 residues), 130.3 bits, E=6.4e-42

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 76% identity to vap:Vapar_4191)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (338 amino acids)

>GFF5723 Flagellar protein FlgJ [peptidoglycan hydrolase] (Variovorax sp. SCN45)
MTVSNTSAGAGAWNTSDAASRAGALDQRFALDVQGVDALRRTVRASPEEGLQQVSRQFEA
MFMNMVLKSMREATPSSGLLDSQNQKIYQSMFDQQLAQNLSGRGVGLAEAMLEQLRRTLP
SGPPDAEADAEIGMRPMLLEPRSTGLPFSPRAGIPIGSAPSGRVSTAADLGVYQYNGDRR
APAANASLQGQVDDFVGRMGASAQAASTASGVPAPLILAQAALESGWGKREIRADDGTQS
FNLFGIKADRSWKGPTVETTTTEYVDGEPQKVRAKFRAYASYDEAFTDYARFITRNPRYA
NVLATDDPHEAAHGLQRAGYATDPKYGEKLVRIMQKFG