Protein Info for GFF5717 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR03424: urea carboxylase-associated protein 1" amino acids 22 to 220 (199 residues), 343.3 bits, see alignment E=1.9e-107 PF09347: DUF1989" amino acids 29 to 193 (165 residues), 236.5 bits, see alignment E=6.6e-75

Best Hits

KEGG orthology group: K09967, hypothetical protein (inferred from 77% identity to reu:Reut_B4884)

Predicted SEED Role

"Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10)" in subsystem Urea decomposition (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.10

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>GFF5717 Urea carboxylase-related aminomethyltransferase (EC 2.1.2.10) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTTTATATAIRLQESALDPAHAVLNQRHPAGEPILFEVKHGQTLRIVDLEGNQAADVLFY
NRHDPAEHYSATDTMQRQGGIYLTTGSVIRSNDGNPMLTIVADTCGRHDTLGGACAAESN
TVRYALQKKYMHSCRDNYLIALQHADVGLGKRDLVPNINFFMNVPVTAEGALSFEDGVSG
PGKYVEMRAEMDLWVLISNCPQLNNPCNAYNPTPIQLLVWD