Protein Info for GFF5714 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Urea carboxylase-related ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 153 to 169 (17 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 273 (169 residues), 99.3 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 41% identical to Y413_METJA: Putative ABC transporter permease protein MJ0413 (MJ0413) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 75% identity to pna:Pnap_0040)

MetaCyc: 35% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Urea carboxylase-related ABC transporter, permease protein" in subsystem Urea decomposition

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>GFF5714 Urea carboxylase-related ABC transporter, permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSSPPVIDISAPPPRRRRTTGLWTVRAPIARRTYWVLALIGLFTPLVLWALLAAFGGLD
PVFLPAPLQVLAKAWTWLTETGLLDDMGISVYRVVTGFLLSAVIALPLGLFIGSYRAVQA
LLEPLTDFIRYMPAVAFIPLVMLWVGIGEGSKIAIIFIGTFFQMVLMVAEDVRRVPAAQV
EAAQTMGANRSELIEKVIFPSAKPALLDTLRITMGWAWTYLVVAELVAANSGLGYAILRA
QRFLQTDTIFAGIIVIGLIGLVTDQLFRLAHRRAFPWLYLKG