Protein Info for GFF571 in Variovorax sp. SCN45

Annotation: 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00885: DMRL_synthase" amino acids 16 to 150 (135 residues), 163.5 bits, see alignment E=1.4e-52 TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase" amino acids 17 to 148 (132 residues), 133.6 bits, see alignment E=2.5e-43

Best Hits

Swiss-Prot: 74% identical to RISB_ACIAC: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 93% identity to vpe:Varpa_3525)

MetaCyc: 44% identical to 6,7-dimethyl-8-ribityllumazine synthase monomer (Bacillus subtilis)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.78

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>GFF571 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) (Variovorax sp. SCN45)
MQGANKGENTPLNGKGLRIGIVQARFNADITDALASACLSELEALGVAANDIHHLQVPGA
LEVPVALQALAERGGYHALVALGCIIRGETYHFELVANESGASVSRVALDYRLPIANAIL
TTENLEQAVARQTDKGRDAARVAVEMAQLLATLS