Protein Info for PS417_02900 in Pseudomonas simiae WCS417

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR02435: precorrin-3B synthase" amino acids 30 to 407 (378 residues), 377.3 bits, see alignment E=4.2e-117 PF03460: NIR_SIR_ferr" amino acids 48 to 95 (48 residues), 38.1 bits, see alignment 1e-13 amino acids 272 to 326 (55 residues), 52.1 bits, see alignment 4.4e-18 PF01077: NIR_SIR" amino acids 114 to 226 (113 residues), 62.1 bits, see alignment E=4.4e-21

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 91% identity to pfs:PFLU0604)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFA5 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PS417_02900 oxidoreductase (Pseudomonas simiae WCS417)
MPPDKAGIIPRLYPSTGSPVNPTPAVNTLRPSACPGLLRIVQALDGGICRIKLAGGSISA
AQACAVADAAQAYAGGVIEATNRANLQIRGIGAEEGALIAMLLAADLGPNNAAGDDVRNL
MLSPSAGIDPQMLFDTRPLAAQILATLQNHPRFHELSAKFAVQLDGGEALAMLEHHHDLW
LSAFVRKGETLLAFGLAGCPGLDAPLAAVPLDQGHALVVAVLEGFLDIATPEQTRMRHLP
VDNVLSRLQLPLLPADGFKRPPSGALLHLGSYPQAQKNQFYVAAIAPLGRLDATMLKGAA
QLASEYGDGTLRFTPWQGVLLPSVEKPHAVTERLAQLGFLCSIDQPLARMTACTGSSGCG
KALADTKADAVQLAALDTGHDVHLSGCPRSCAAAHTAPVTLLAVSPGHYDLYFREAAQPG
FGRLHARNLSIEATGALLRARPRSNTDD