Protein Info for PS417_00290 in Pseudomonas simiae WCS417

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 327 to 356 (30 residues), see Phobius details amino acids 377 to 404 (28 residues), see Phobius details PF00916: Sulfate_transp" amino acids 13 to 382 (370 residues), 204.5 bits, see alignment E=2.3e-64

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU0056)

Predicted SEED Role

"Sulfate transporter family protein in cluster with carbonic anhydrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2Z3 at UniProt or InterPro

Protein Sequence (515 amino acids)

>PS417_00290 SulP family inorganic anion transporter (Pseudomonas simiae WCS417)
MRAAQLKAVLPRELLASVVVFLVALPLCMGIAIASGMPPAKGLITGIIGGLVVGWLAGSP
LQVSGPAAGLAVLVFELVRQHGMLMLGPILLLAGFLQLVAGRLRLGCWFRVTAPAVVYGM
LAGIGVLIVLSQIHVMLDGAPKPSGLDNLTGFPAALAEAIPILGGGLGWQAGLLGLSTML
VMYAWDKLRPQRLRFVPGALLGVGLTTVVSLVLALQVKRVEVPENLADAIDWLRPSDLLN
LADPQLLIAAFAVAFIASAETLLSAAAVDRMHSGQRSDFDKELSAQGVGNMLCGLLGALP
MTGVIVRSSANVQAGATTRLSAMFHGLWLLAFVLLLSSVLQSIPVASLAGVLVYTGIKLV
DIKAFKALGRYGRMPMFTYAATALAIIFTDLLTGVLVGFGLTLVKLAFKASRLKVSLIDL
PQEGEMELRLTGAATFLKVPALTQVLSTVPAGSTVHVPLSNLSYIDHSCLELLEEWGRAN
AAKGSTLVIEARGLKRRLEGRVRTTTGIGSAPSVS