Protein Info for GFF5695 in Variovorax sp. SCN45

Annotation: Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9), FabV => refractory to triclosan

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF12242: Eno-Rase_NADH_b" amino acids 2 to 80 (79 residues), 130 bits, see alignment E=3.4e-42 PF12241: Enoyl_reductase" amino acids 82 to 317 (236 residues), 361.8 bits, see alignment E=2.2e-112 PF07055: Eno-Rase_FAD_bd" amino acids 323 to 386 (64 residues), 90.7 bits, see alignment E=9.2e-30

Best Hits

Swiss-Prot: 86% identical to FABV_VARPS: Enoyl-[acyl-carrier-protein] reductase [NADH] (fabV) from Variovorax paradoxus (strain S110)

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_4699)

Predicted SEED Role

"Short-chain alcohol dehydrogenase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF5695 Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9), FabV => refractory to triclosan (Variovorax sp. SCN45)
MIIKPRVRGFICVTTHPTGCEANVQQQIDYVKAQAPIAGGPKKVLVVGASTGYGLAARIT
ATFGCGADTLGVFFERAGSENRPGSPGWYNTAAFHRAAEAEGRYAKSINGDGFSDEVKQL
TIDAIRADLGQVDLVVYSLAAPRRTHPKTGQVFNSVLKPIGKSVSLRGLDTDSGTVKESV
LEPATQEEIDNTVAVMGGEDWQMWIDALQQAGVLADGAKTTAFTYLGEQITHDIYWNGSI
GAAKKDLDQKVLGIRETLAAKGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEQGT
HEGCIEQVHGLYADSLYGSAPHIDDEGRLRADYKELAPQVQSRVLELWPQVTNENLNAIS
DFAGNKTEFLRLFGFGVEGVDYEADVNPDVGISNLVQA