Protein Info for GFF5693 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 79 to 94 (16 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details PF00487: FA_desaturase" amino acids 37 to 290 (254 residues), 122.8 bits, see alignment E=1.1e-39

Best Hits

KEGG orthology group: None (inferred from 68% identity to vei:Veis_4769)

Predicted SEED Role

"Fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF5693 Fatty acid desaturase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTSVFRYEDGVWPNVAALAFTLLGWPAGIVLLGQANGWLNALGVLLVAQTLVWSAYFIHE
FAHYAIFKTPQANERWGTLMSWINGSCFASFADLRRKHMRHHVERADVITFDAQAFLRAH
PVIRRTVLALEWAYVPAVEFVMRGFVIAMPFMGEKKKAARGRVIGIALVRIAAWVALGWW
SLKALVLYALAYLIFVTVLRFADCFQHTYDAYPILDDTPIPKDKVRDRVYEQANTFSDVV
SLDAKWLNLVWLNFGFHNAHHERPTAPWYRLPAFHRELYPADYAQVVTVRELLRSFHINR
VRRVLASNYGAVQPPGTPGRADGFLGAVGVSFLTAV