Protein Info for GFF5690 in Variovorax sp. SCN45

Annotation: Glutamate/aspartate ABC transporter, ATP-binding protein GltL (TC 3.A.1.3.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00005: ABC_tran" amino acids 19 to 165 (147 residues), 129.9 bits, see alignment E=1e-41 PF13304: AAA_21" amino acids 134 to 196 (63 residues), 28.1 bits, see alignment E=2.1e-10

Best Hits

Swiss-Prot: 62% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: K10041, putative glutamine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 92% identity to vap:Vapar_4041)

MetaCyc: 59% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF5690 Glutamate/aspartate ABC transporter, ATP-binding protein GltL (TC 3.A.1.3.4) (Variovorax sp. SCN45)
MIELEKVNKWYGSYHALVDVTETIHKGEVVVVCGPSGSGKSTLIRTFNRLEPIQSGRIVV
DGQDIQAPGLDVNAFRSRIGFVFQQFNLFPHLTVLQNCTMAPMQLRGLSRKQADERAMAL
LHRVGLSNKANAWPSELSGGQQQRVAIARALAMQPPLMLFDEPTSALDPEMVGEVLLVMR
DLTRDGMTMVCVTHEMGFAREVADRVLFMDEGKVLERATPDDFFNRPQHPRARQFLSDIR
SPFSRDA