Protein Info for GFF5678 in Variovorax sp. SCN45

Annotation: Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details TIGR01433: ubiquinol oxidase, subunit II" amino acids 28 to 259 (232 residues), 352.8 bits, see alignment E=3.5e-110 PF00116: COX2" amino acids 170 to 240 (71 residues), 28.6 bits, see alignment E=1.1e-10 PF06481: COX_ARM" amino acids 264 to 303 (40 residues), 54.9 bits, see alignment 6.5e-19

Best Hits

KEGG orthology group: K02297, cytochrome o ubiquinol oxidase subunit II [EC: 1.10.3.-] (inferred from 90% identity to vap:Vapar_4046)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>GFF5678 Cytochrome O ubiquinol oxidase subunit II (EC 1.10.3.-) (Variovorax sp. SCN45)
LWGLFASPPHLFSPGMHILKNLRRSLLLLPAVLLAGCNTVLMNPSGDIAHQQGRLIVVST
VLMLIIIIPVIALTIFFAWRYRQSNKEATYSPDWDHSTQLELAIWAAPLLIIIALGAITW
ISTHVLDPYQPLRRLDAQRPIPADTKPLVVEVVALDWKWLFIYPEQGIATVNELAAPVDR
PISFKITASSVMNSFFIPALAGQIYAMPGMETKLHAVINKPGEFDGFSANYSGAGFSGMR
FKFHGLSDGDFDQWVQKVKSGKDGELTRELYKKLEAPSEREPVRHYAAVDPALYDAILNL
CVDRNKMCMKEMMAIDADGGMGKPGAFNVATKQAWLTDSLDSPKRKYVTAMCTTEE