Protein Info for GFF5676 in Variovorax sp. SCN45

Annotation: Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 19 to 199 (181 residues), 61 bits, E=8.4e-21
• TIGR02842: cytochrome o ubiquinol oxidase, subunit III
  • amino acids 22 to 200 (179 residues), 276.4 bits, E=7.1e-87

Best Hits

Swiss-Prot: 63% identical to CYOC_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas putida

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 92% identity to vap:Vapar_4048)

MetaCyc: 63% identical to cytochrome bo terminal oxidase subunit III (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (2/2 steps found)
• proline to cytochrome bo oxidase electron transfer (2/2 steps found)
• pyruvate to cytochrome bo oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• D-lactate to cytochrome bo oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Protein Sequence (202 amino acids)

>GFF5676 Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-) (Variovorax sp. SCN45)
VTAPAFDVFNVRNEDHHPENGTLLGFWLYLMSDCLIFACLFAVYGVLGRSYAAGPSGADL
FDLPLVAINTSLLLLSSITYGFAMLQMQQRRMGGVLVWLAITGLLGAGFIGLELYEFAHL
IHEGAGPQRSAFLSSFFALVGTHGLHVTFGIVWLIVLMIQLPKHGFTAANRRRLMCLSMF
WHFLDVVWIGVFTFVYLMGSLQ