Protein Info for GFF5675 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Acyl-CoA thioesterase II (EC 3.1.2.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13622: 4HBT_3
  • amino acids 36 to 113 (78 residues), 40 bits, E=5.6e-14
• PF20789: 4HBT_3C
  • amino acids 164 to 289 (126 residues), 77.7 bits, E=1.6e-25
• PF02551: Acyl_CoA_thio
  • amino acids 185 to 286 (102 residues), 61.6 bits, E=1.1e-20

Best Hits

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 60% identity to bur:Bcep18194_C7119)

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (293 amino acids)

>GFF5675 Acyl-CoA thioesterase II (EC 3.1.2.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAQATWNDLDIEALLTLDPLGEGRWRSRQGDANLNGRSYGGQLLGQALMAALMEVPADRE
ATMMQFLFLQGAMPDEPLDFAVSALQEGKRFSSRHVRGVQGNGRTVLDAQVTCALPLDAP
THASPSTAPPGERPEDLAQLHEVDPVLITDLARLGGYSQNRKPSIDFRIPDPSRQLSQSL
MNGRFRFWMRAIKPLPDDARLQAAAFAYLSDWWLNFCSLGLHLRDLNGRPLYISSLNHAL
WLHRPVRADQWLHVDCSSPCAQAGRGLSIGAVHDLQGQQLATMTQECLMAYAG