Protein Info for GFF5673 in Variovorax sp. SCN45

Annotation: Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 304 to 405 (102 residues), 61.2 bits, see alignment E=6.1e-21

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 94% identity to vpe:Varpa_4716)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF5673 Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-) (Variovorax sp. SCN45)
MQQLIQLRWFAVVGQVVTILVVHYGFAIRLPLDHMLQVLTCLALFNMVSLLRARSHRRVT
NGELFLALLVDVATLTAQLYLSGGATNPFVFLFLLQVTLGAVLLKAWSTWTIVVITSICF
AGLALFSRPLALPLDHNRGLWSPYIQGMLVCFALNAALLVIFITRISRNLRARDARLADL
RQRASEEEHIVRMGLLASGAAHELGTPLATLAVILGDWRRLPHFSSDPELLTEVAEMELQ
IQRCKSIVSGILLSAGEARGESSEETTVSTFLDDLIEEWRTTRPIEDFEYDNHFGRDLPM
VSDSALKQMICNVLDNALEASPHWLRLEAAHDADALTITVTDAGPGFLPAILKEFGKPYQ
SSKGRPGGGLGLFLVVNVARTVGGRVAAGNRPEGGAIVKITLPLAAIVLEEEEDEDDDGE
QEAEETLDRGTTETQTRP