Protein Info for GFF5670 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13577: SnoaL_4
  • amino acids 9 to 142 (134 residues), 35.7 bits, E=8.1e-13
• PF00866: Ring_hydroxyl_B
  • amino acids 17 to 150 (134 residues), 93.6 bits, E=1.3e-30

Best Hits

KEGG orthology group: None (inferred from 51% identity to bpe:BP2092)

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

• benzoate degradation I (aerobic) (1/2 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• meta cleavage pathway of aromatic compounds (3/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (3/13 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.10

Protein Sequence (161 amino acids)

>GFF5670 Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLDARSLLDEVTQFIYREARYQDDHAYDEWEALWTDDGVYWIPANGEGGDPEKEMSIIYD
NRSRIALRIRQFHTGKRYSQTPQSRLRRVVSNVEILKNEGEELLVTSNAMVFESSPSRGD
TLWASRNEYTLRREGEALRMARKKVVLVNNETALYSMAFLI