Protein Info for GFF567 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13302: Acetyltransf_3" amino acids 4 to 137 (134 residues), 47.9 bits, see alignment E=6e-16 PF13420: Acetyltransf_4" amino acids 6 to 155 (150 residues), 46 bits, see alignment E=1.5e-15 PF00583: Acetyltransf_1" amino acids 34 to 136 (103 residues), 60.4 bits, see alignment E=5.2e-20 PF13673: Acetyltransf_10" amino acids 39 to 137 (99 residues), 39.2 bits, see alignment E=1.7e-13 PF13508: Acetyltransf_7" amino acids 54 to 137 (84 residues), 38.3 bits, see alignment E=3.5e-13

Best Hits

Swiss-Prot: 82% identical to AAAT_ECOLI: L-amino acid N-acetyltransferase AaaT (aaaT) from Escherichia coli (strain K12)

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 98% identity to seg:SG3891)

Predicted SEED Role

"Putative acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>GFF567 Putative acetyltransferase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSEIVIRHAEPKDYDAIRQIHAQPEVYHNMLQVPHPSLEMWQARLTEQAGVKQLVACIDD
IVVGHLSIQVTQRPRRSHVADFGICVDARWHNRGIASALIRTMIDMCDNWLRVDRIELTV
FVDNEPAVAVYKKYGFEIEGTGKKYGLRNGEYVDAYFMARVK